SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008195 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008195
Domain Number 1 Region: 6-93
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.31e-20
Family Canonical RBD 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008195   Gene: ENSMODG00000006606   Transcript: ENSMODT00000008360
Sequence length 294
Comment pep:novel chromosome:BROADO5:1:169839236:169882118:-1 gene:ENSMODG00000006606 transcript:ENSMODT00000008360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNVTNKTDPRSMNSRVFIGNLNTLVVKKTDVEAIFSKYGKIVGCSVHKGFAFVQYVNE
RNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYY
DRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSSKSGKLKGDD
LQTIKKELTQIKQKVDSLLESLEKIEKEQSKQTVEMKNDKSEEEQSSSSLKKDETNVKME
SEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS
Download sequence
Identical sequences F6ZWV5
XP_003755856.1.9362 XP_007479836.1.35504 XP_020858598.1.61212 ENSMODP00000008195 ENSMODP00000008195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]