SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008201 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008201
Domain Number 1 Region: 320-366
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000000733
Family CCCH zinc finger 0.00087
Further Details:      
 
Domain Number 2 Region: 288-314
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000144
Family CCCH zinc finger 0.0012
Further Details:      
 
Domain Number 3 Region: 261-285
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000196
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008201   Gene: ENSMODG00000006612   Transcript: ENSMODT00000008366
Sequence length 1180
Comment pep:known_by_projection chromosome:BROADO5:1:594283224:594334095:1 gene:ENSMODG00000006612 transcript:ENSMODT00000008366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REDGELEDGEIDDAGFEEIQEQPETKGNDKQKKKRQFGKAFIGCRIENQRKMKKDSFAAV
RHNSPSSDDSSDYSLDSDVEHTERSHKKGSSSYRDYDSSFLQHGHLSGNYMISQKSQHNK
KSKNKDYDDYSNYSDDNFDNYNQETEEDFADHLKQYRQAKETSNPALGSPFHKESGKKQG
MKGVQPGKYKIETKSRSKSFSVCRGRGLPKKLKRKERGRGRGSKGPNAFSGTDGFQEDGK
PMKKWVNMSQEFINQHTVEHKGKQICKYFLEGRCIKGDQCKFDHDAELEKKKEICKFYIQ
GYCTKGENCIYMHNILLKIYTKCYLGDKCKFSHAPLTKETKELLDKLLNTEEEPQNEDKK
DLEDLRRRGIAPLPKPPPGVGLLPTPPEHFSFSESEDNFQADLSDEFKKIPSLFEIVVKP
TVDLAHKIGKKPPAFYNSASPPGPQFQGNNPHPQHMYSSGSSPGPGPNMSQGHNGPAVHP
GSPGHHQCTGPPGPPMPHSPPLQPGPPGFLGPHNQAGGPIQPGPPLTPPGMSGSYNSTGV
QGHMMNITIENHCSSGPSYQQGPSEMQLNANYESLQNSAEFYDNYYSHQAVHNFQTANNS
GDAMWHGEFAEHQPHLTQDLLNSGSEKDCINTSGHKPAINVPDFLPAMQKALFVRLSQKH
QEDGEPVGHQSQKTLSREEDDNVNWYSSSEEEEGSSVKSILKTLQKQTETLRNQQQHSTE
LGTPTDPRLAKDKNTGNQAVDPRLRAVPRQSARKPSDSAPFDPRLTRDPRKLKLNESGHA
SPSVSGGKFDLQHSNSGVKTKQKGVDDEEEETERELREKAFLIPLESLPGITLQDPRSQL
RQFSHIKMDITLTKPNFAKHIIWAPEDLLPVPLPKPDPVSSINLPLPPLIADQRLNTLRN
INSDLHQSTMPADPRLAAKAKNNTTRSAFLDQPGDTHSPGNKLGDPRLQKNVDPRLHRLS
STDSHHGNAKDPHPSKFDPRLARPSPGSSQTSGSVTNKSESDPLPPYAPKLSASTGVRLG
TPSSILSGISLYDPREHGSLSLSEPTSLSLGENGENQKKISGLQNNSKNEPSSSEALQKT
TPNLEKITDGPVDSQSEKQNSSVKIQVKPEPPHSSTAPAVHNLPIQALTGLIRPQYSDPR
QTRQPGQVNQTPDNDPNGESDDKSLKDVFKTFDPTASPFC
Download sequence
Identical sequences F7GEW5
13616.ENSMODP00000008201 ENSMODP00000008201 ENSMODP00000008201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]