SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008229 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008229
Domain Number 1 Region: 99-207
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-37
Family Second domain of FERM 0.00000227
Further Details:      
 
Domain Number 2 Region: 12-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-24
Family First domain of FERM 0.0000168
Further Details:      
 
Domain Number 3 Region: 209-264
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000799
Family Third domain of FERM 0.00045
Further Details:      
 
Domain Number 4 Region: 312-397
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000082
Family Third domain of FERM 0.0000727
Further Details:      
 
Domain Number 5 Region: 561-603
Classification Level Classification E-value
Superfamily Moesin tail domain 0.000000131
Family Moesin tail domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008229   Gene: ENSMODG00000006634   Transcript: ENSMODT00000008394
Sequence length 603
Comment pep:novel chromosome:BROADO5:2:508487874:508559025:1 gene:ENSMODG00000006634 transcript:ENSMODT00000008394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NMSIRGLKKKQPKTFKVKVITMDAEMDFSCEMKWKGKDLFDLICRTLGLRETWFFGLQYT
SKGVCAWLKMEKKVLEQEIPKEDPIKFHFLAKFYPEKVEEELLQEVTQHLFFLQVKKQIL
DEEIYCSPEATVLLASYAVQAKYGDYDPNFHEPGFLAQDELLPQRVLKQYQMTAHMWEEK
ITAWYAEHRGIARDEAEMNYLKIAQDLAMYGVNYFPIEQNKNHTDLLLGVDAKGIHVYSI
NNRFSPNKSFEWSAIRNISYSEKEVGGDGQVVTFSFICFPSGSSNGNLVTEGRLTKDLLV
AFLLTMFSCLHQLTIKPLDKKAEVFKFFSSQLKVNKLILQLCIGNHDLFMRRRRVDSIEI
QQMKAQAKEEKARKKVEHQRLAREKQLREEAERAKDELERRLFQLEAEARQANEALVKKP
QLLVSQNLRERRGLPLIRKPPKTNQHNQGLHPAPTASLNCQRERETPLDQKAPPKQTSTI
RVFSQPQLPERETEYLRQDLSEAREAERRAKQRLLDVTRVSHPVCWLIGTLLRWYPQLSP
VRGGDLGAEKGCTRFDSKDIDLKRLSLEIERERLDYLEKSKKFEDRLKELKSEIHALKLE
EKQ
Download sequence
Identical sequences F7G4H7
ENSMODP00000008229 13616.ENSMODP00000008229 ENSMODP00000008229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]