SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008365 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008365
Domain Number 1 Region: 166-268
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 50-136
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000753
Family Growth factor receptor domain 0.0045
Further Details:      
 
Domain Number 3 Region: 122-165
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000875
Family Ovomucoid domain III-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008365   Gene: ENSMODG00000006751   Transcript: ENSMODT00000008532
Sequence length 269
Comment pep:novel chromosome:BROADO5:1:370148726:370196144:1 gene:ENSMODG00000006751 transcript:ENSMODT00000008532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPKIIGLCAFHLKMKPLVSTTMLMVLMQVFQSLPTLYQGSWQRFLREGDNCGKCDLELCS
QPENCLAGTVLDRCGCCSECGNREGQICDLDGNNHSYGQCGKNLECILNTEVMEYGEVPE
PQCVCGSPESVCGPEGKTYENICQFNEIYSQKKINVSIKHKGPCESAPVISLAPEDTENF
MGNDIIFRCEVSAYPIPHLEWKKKGNKIFLPGDDAHISIQVRGGPQKHGMTAWLQIQGIR
KSDEGVYICHTRNKYGTTYASARLKVINP
Download sequence
Identical sequences F7CCQ3
13616.ENSMODP00000008365 ENSMODP00000008365 ENSMODP00000008365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]