SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008450 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008450
Domain Number 1 Region: 114-220
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.42e-26
Family Canonical RBD 0.00013
Further Details:      
 
Domain Number 2 Region: 20-106
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.03e-24
Family Canonical RBD 0.0000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008450   Gene: ENSMODG00000006825   Transcript: ENSMODT00000008618
Sequence length 243
Comment pep:novel chromosome:BROADO5:6:120674100:120675004:-1 gene:ENSMODG00000006825 transcript:ENSMODT00000008618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDVNEYSNMEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSCFGEVIDCTV
KTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKELPKKVFVGG
LSPDKSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLENRYHQIG
SGKCEIKVAQPKEVYRQQQQQQKGGGTAAGGRGGTRGHYSGQQSTYGKASRGGGNHQNNY
QPY
Download sequence
Identical sequences F6PGA6
ENSMODP00000008450 13616.ENSMODP00000008450 ENSMODP00000008450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]