SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008500 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008500
Domain Number 1 Region: 560-672
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.72e-24
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 701-773
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.98e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 153-294
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.61e-17
Family G proteins 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000008500
Domain Number - Region: 24-117,421-470,604-626
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00832
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008500   Gene: ENSMODG00000006861   Transcript: ENSMODT00000008668
Sequence length 777
Comment pep:known_by_projection chromosome:BROADO5:1:251225297:251289901:1 gene:ENSMODG00000006861 transcript:ENSMODT00000008668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQASLAEKGLNPGLMCQESYACSGTDEAIFECDECCSLQCPRCEEELHRQERLRNHER
LRLKPGHVPYCDPCKGPNGHSPGVRQRAAVRCQTCKINLCLECQKRTHSGGSKRRHPVTI
YHVSKAQEQLEGEGMDEETKRKKMTENVVSFLLVDETEEIQVINEEDFIKKLDCKPDQHL
KVVSIFGNTGDGKSHTLNHTFFYGREVFKTSPAQESCTVGVWAAYDPVHKVAVVDTEGLL
GATVNLSQRTRLLLKVLAISDLVIYRTHADRLHNDLFKFLGDASEAYLKHFTKELKATSA
RCGLDVPLSTLGPAVIIFHETVHTQLLGSDHPSEVPEKLIQDRFRKLGRFPEAFSSIHYK
GTRTYNPPTDFSGLRRALEQQLENNTTRSPRHPGVIYKALKALSDRFSGEIPDDQMAHSS
FFPDEYFTCSSICLSCGSGCKNSMNHGKEGVPHEAKSRCRYSHQYDNRVYTCKACYERGK
EVSVVPKTSASTDSPWMGLAKYAWSGYVIECPNCGVVYRSRQYWFGNQDPVDTVVRTEIE
HVWPGTDGFLKDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQ
ILNCNKCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRVCDTCFDARNI
HLDVPEAQVDEEGGTLIARKVGEAVQNTLGAVVTAIDIPLGLVKDAARPAYWVPDHEILH
CHNCRKEFSIKLSKHHCRACGQGFCDECSHDRRAVPSRGWDHPVRVCFNCNKKPGDL
Download sequence
Identical sequences F6PXN5
ENSMODP00000008500 ENSMODP00000008500 XP_001368301.1.35504 13616.ENSMODP00000008500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]