SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008528 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008528
Domain Number 1 Region: 389-498
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-22
Family SH2 domain 0.00072
Further Details:      
 
Domain Number 2 Region: 9-73
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000114
Family SAM (sterile alpha motif) domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008528   Gene: ENSMODG00000006879   Transcript: ENSMODT00000008696
Sequence length 519
Comment pep:known_by_projection chromosome:BROADO5:1:369179019:369258047:-1 gene:ENSMODG00000006879 transcript:ENSMODT00000008696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSNVPYRSEVLAWGPDELAEYFKKLNYKDCEKVVKKHHISGPRFLNLSENDIQKFPKL
RVPILSKLSQEINKNEERRSLFARKPHPQKFADEREFQEEEDGGWSSFDEDDDYESPTED
ADGEEDGDYESPNEEEAPALEDEADYEPPPSNDEDTMQNTILPAKIPSGSMYIDRPLTGK
TPQQPPVPPQRPLPGTGGRNNTPPHLPQPSHEEPMRGRNHRTPNFPAPSIDRSKKPPLDR
TLPQFERDSLAIGKKPLFPDKPSAPALRPAGDHLPKIQKPPLPPGERPERNFKKPPVPKH
GWAADRRDEEDDVQQRPLPQPALPSFTSNTFPSRSIKPPSRFPQSGSNSMPGPMTTSIFP
SSSTLPPYLSKGPFNRPPSRGPAEGRPLPVPVRQQHLGDEENSLNNEWYVSYITRTEAEA
ALRKINKDGTFLVRDSSKKTVTNPYVLMVLYKNKVYNIQIRYNEESQVYLLGTGLRGKED
FLSVPDIIDYFRRMPLLLIDGKNRDSRNQCMLIYAAGYP
Download sequence
Identical sequences F6PWB0
ENSMODP00000008528 ENSMODP00000008528 XP_007474053.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]