SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008570 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008570
Domain Number 1 Region: 53-96,123-143
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000237
Family Canonical RBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008570   Gene: ENSMODG00000006914   Transcript: ENSMODT00000008740
Sequence length 284
Comment pep:known_by_projection chromosome:BROADO5:8:17580064:17582793:1 gene:ENSMODG00000006914 transcript:ENSMODT00000008740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMAAGKKTRVEKAPAGALSPPGYRAVPIQFSPERTASHYLYLKEHRVREGTGSAWPPGRT
LFVLNVPPYCPEERLAQLFSDCCGPVQSVKLHPKPDLSQRPGEPSTAAASELFRPKPVPG
FQVAYLVFRKRASVQKAVALQGPLIVSTESCPVKTGIEKWIADYAASLGDPEALRVEVDK
FMEEYDKKVAQEDARAEAEEGVPDEEGWVKVTRKGRRPGLPRSEAASLRVLEKEKRKKAR
KELLNFYAWQHRETKMEHLAQLRKKFEEDKQRILMRAQRKFRPY
Download sequence
Identical sequences F6PSH1
13616.ENSMODP00000008570 ENSMODP00000008570 ENSMODP00000008570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]