SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008593 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008593
Domain Number 1 Region: 554-636
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-16
Family Canonical RBD 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008593   Gene: ENSMODG00000006932   Transcript: ENSMODT00000008763
Sequence length 702
Comment pep:known_by_projection chromosome:BROADO5:8:17516579:17579657:1 gene:ENSMODG00000006932 transcript:ENSMODT00000008763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPAPPPFSFPVLPSFLGAGVGVIAGPLSLFCCHPSMPPCFLLSSWRLLGFCLSVMGLDP
RSTGLSAPKPKGAGQARCGSPLLRGFSGGRQSRVISAEADPGRLRASGLPAAPARWISLL
KGQVVPFLLGVCGQGLAGWRAVLPTLVSVPAGLSLSSGPPFQHRGPGARDLKPGRRRPSF
PFLPLGAIAEEEFFSGDVMAIESPGLEALARRPARDGRAQWPALCSRAPKVSSPAVLLGQ
GPWKGCPFLACKGRPKEAPPPACSCSAGSRGTSHWTSLSLDEPLGPSLLAGPAEVRPSGR
VKGRLNARPGIGGIRSRIGLPQTLLSRPAPAPGFQQMFDARQKIGLTDARQKLGVKDARE
KLVQKDARFRIKGKVQDAREMLNSRKQIVAPEKGAKVADAREKISLKRGSPASLLRPATD
PLPPAMKITKTIQQKAALPALPHPAGMRINVVNNHQQKQGLYDVDEDDEAASAPIAGKQM
KITTTNSFLQQMAGLSSSKFSLSKTLPLTKVVQNDTYTALPAPPSPLRTKALTNMSRTLV
TKEEPPKEMPPAEPIFSPLEGTKMTVNNLHPRVTEEDIVELFCVCGALKRARLVHPGVAE
VVFVKKEDAITAYKKYNNRCLDGQPMKCNLHMNGSIITSDQPILLRLSDSPSVKKEGEPR
RLSSGASSHPPAEVDPDTILKALFKSSGASVSVQPTEFKIKL
Download sequence
Identical sequences F6PQY3
ENSMODP00000008593 ENSMODP00000008593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]