SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008671 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008671
Domain Number 1 Region: 29-247
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.59e-56
Family Ribonuclease H 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008671   Gene: ENSMODG00000006997   Transcript: ENSMODT00000008842
Sequence length 307
Comment pep:known_by_projection chromosome:BROADO5:3:429172733:429181784:-1 gene:ENSMODG00000006997 transcript:ENSMODT00000008842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLGDFERDNTGSCRLSSPVPELCRTEDCCLGIDEAGRGPVLGPMVYGICFCPLSRLGDL
EALKVADSKTLSEAERERLFGKLDQARDFVGWALDILSPNLISNSMQRRAKYNLNSLSHD
TAMALVQLALDQGVKVTQVFVDTVGPADKYQQKLQERFPELEVTVRPKADSLFPVVSAAS
ICAKVARDQVVKRWKFLEDLGDLKMDYGSGYPNDPKTKEWLSQCLDPVFGFPQFVRFSWS
TAQLILDGRAVPVRWEDSEEEAGDPPAAGRGSSTPSLLSFFARRQTPTERQPHRFFHERG
LETVADL
Download sequence
Identical sequences F6XVJ9
ENSMODP00000008671 ENSMODP00000008671 XP_007488540.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]