SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008714 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008714
Domain Number 1 Region: 9-101
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.63e-23
Family La domain 0.0000188
Further Details:      
 
Domain Number 2 Region: 102-165
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000111
Family Canonical RBD 0.00016
Further Details:      
 
Domain Number 3 Region: 177-274
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000158
Family Canonical RBD 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008714   Gene: ENSMODG00000007027   Transcript: ENSMODT00000008886
Sequence length 346
Comment pep:novel chromosome:BROADO5:2:147260987:147262203:-1 gene:ENSMODG00000007027 transcript:ENSMODT00000008886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENGDSEKMTDLESQICQQIACYFGDFNFPRDKFLKEQIKIDDGWVPLEIMIKFNRLSK
LTKDFDVIRSDLKKTKAEHMEVSEDKTKIRRSPSKPLPEVTDEYKNEVKNRSIYVKGFPT
DATLDDIKEWLEGKGQVQNIQMRQTLHKACKGSIFVVFDKEAELKSLDEKIGSLLKFSGD
LDDQICREVLHTRFSNYGEIKWIDFIRGAKEEIILFKGKAKEALEKANEANSGYLKLRNK
DVTLEVLEGVMEKEALKKIIEDQQESLNKLKSKGRKFKGKGRGGKAVQGTPNKGKIQFQG
KKTKFDSDVEQENGDAGGSLKRTREETKNEESAPKQLKTENGAGDQ
Download sequence
Identical sequences F6UFU6
ENSMODP00000008714 13616.ENSMODP00000008714 ENSMODP00000008714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]