SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008720 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008720
Domain Number 1 Region: 32-238
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.29e-38
Family DnaQ-like 3'-5' exonuclease 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008720   Gene: ENSMODG00000007032   Transcript: ENSMODT00000008892
Sequence length 696
Comment pep:known_by_projection chromosome:BROADO5:6:60015894:60033771:-1 gene:ENSMODG00000007032 transcript:ENSMODT00000008892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATKQLARQLGLIRRKSISPANKDSLGRIRPKQLFDYLIIIDFESTCWNDGKHHYSQEII
EFPAVLLNTLTGEIESEFQTYVQPEEHPILSKFCIELTGIKQAQVDEGVPLKICLSQFCK
WIHLIQQQKKITFAPSITNNSASEVKSCAFVTWSDWDLGVCLEYECRRKQLRKPIFLNSW
IDLRATYKLFYRRKPKGLSGALQELGIEFSGREHSGLDDSRNTAHLAWRMIRDGCIMKIT
KSLDKVPPSKKSPDYVARALTLNQTEDTPGHENTIQTSSTDGFCDDAINIGKNNTNPNGK
SHLMSTSMSSFVKTHQDYLPSSESTRNLSAVKSCFSVNESSLPLGKLQPPNSYSPGYGQN
QIKGECLIQHPKYNSSVLGSELVLVSTTISSINNISDTDTSTSLDCLPLLTDWEDVALLP
ASCPGQNIDFAPSTNDSRPGTTLDPGEKLMVSKESTMINYTDLGTLGKAPQTPETSRSIV
YRSPHTTIYNVKESPNQPSNVDTFKLPNLKVNLLNRTNTVLSSPSTLGEPKTPYSVVIKR
KSSSPQVFSPIKKQSFKIHEEMPAFSHCLPVKNSCPKVTSSVLTSTVNLQDPRKNGKMTP
PLCNCGRRSKRLIVSKNGPNHGKAFYSCPVGKYQKNRKNCGYFKWEQTLQKERTNGMDCS
LSTVGINYRSPGTCNSSTNLIFSPKKCLKLRPSMRN
Download sequence
Identical sequences F6UFS2
ENSMODP00000008720 XP_001366655.1.35504 ENSMODP00000008720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]