SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008836 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008836
Domain Number 1 Region: 83-187
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000206
Family Canonical RBD 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008836   Gene: ENSMODG00000007123   Transcript: ENSMODT00000009010
Sequence length 551
Comment pep:known chromosome:BROADO5:8:26533721:26568340:-1 gene:ENSMODG00000007123 transcript:ENSMODT00000009010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDALPPSV
GDDVGKGSAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRAN
GQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFEMQSRKTTQSGQM
SGEGKAGPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPAGQTPPRPP
LGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPV
PGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPA
FFPPPTNSGMPTSDSRGPPPTDPYGRPPPYDRGDYGPPGREMDAARTPLSEAEFEEIMNR
NRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGI
ESKSYGSGSRRERSRERDHSRSREKSRRHKSRSRDRHDDYYRERSRERERHRDRDRDRDR
ERDREREYRHR
Download sequence
Identical sequences F6SH96
ENSMODP00000008836 NP_001165832.1.35504 XP_020845891.1.61212 ENSMODP00000008836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]