SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009010 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009010
Domain Number 1 Region: 223-391
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.53e-18
Family Canonical RBD 0.00073
Further Details:      
 
Domain Number 2 Region: 437-529
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.78e-17
Family Canonical RBD 0.0016
Further Details:      
 
Domain Number 3 Region: 28-169
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000118
Family DnaQ-like 3'-5' exonuclease 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000009010
Domain Number - Region: 622-662
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0103
Family Canonical RBD 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009010   Gene: ENSMODG00000007268   Transcript: ENSMODT00000009187
Sequence length 681
Comment pep:known_by_projection chromosome:BROADO5:3:358183979:358284239:1 gene:ENSMODG00000007268 transcript:ENSMODT00000009187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASPDYLVVLFGITAGATGAKLGSDEKELILLLWKVVDLANKKVGQLHEVLVKPDHLEL
TEDCKEETKIDAENLSSAPQLEQALRQFNQSVSNELNIGVGTSFCLCTDGQLHVRQILHP
EASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVAAMTDCLHLDKSVPTSRYGASE
VEDMGNVILTMISEPYNHRFSDPERVNYKFESGTCSKMELVDDNTIVRARGLPWQSSDQD
IARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHMGNRYIEVYKA
TGEDFLKIAGGTSNEVAQFLSKENQVIVRMRGLPFTATAEEVLAFFGQHCPITGGKEGIL
FVTYPDGRPTGDAFVLFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQQVLNRFSSTP
LIPLPTPPIIPVLPQQFVTPTNVRDCIRLRGLPYAATIEDILEFLGEFSTAIQTHGVHMV
LNHQGRPSGDAFIQMKSADRAFMAAQKCHKKTMKDRYVEVFQCSAEEMNFVLMGGTLNRN
GLSPPPCKLPCLSPPSYTFPAPAAVIPTEAALYQPSVLLSPRTLQPSTAYYPAGAQLFMN
YTAYYPSPSGSSNSIGYFPTAGNASSIPPQHGTVVRMQGLAYNTGVKEILNFFQGYQYAA
EDGLVHTNDQARTLPKEWVCI
Download sequence
Identical sequences F7FQS7
ENSMODP00000009010 XP_007488184.1.35504 ENSMODP00000009010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]