SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009019 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009019
Domain Number 1 Region: 56-383,413-525
Classification Level Classification E-value
Superfamily Ras GEF 5.49e-122
Family Ras GEF 0.0000333
Further Details:      
 
Domain Number 2 Region: 645-739
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.81e-40
Family Ras-binding domain, RBD 0.00000757
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009019   Gene: ENSMODG00000007272   Transcript: ENSMODT00000009196
Sequence length 773
Comment pep:known_by_projection chromosome:BROADO5:2:78909101:79074293:1 gene:ENSMODG00000007272 transcript:ENSMODT00000009196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLNDAYLPSSCLSSIQDWGEEVEEGAVYHVTLKRVQIQQAANKGARWLGVEGDQLPPG
HTVSQYETCKIRTIKAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLD
RYGNLRSPNCEEDRSPNSSECKTVLRNAIASILRAWLDQCAEDFREPPHYTCLQKLLDYL
KRTMPGSDPERRAQNLLEQFQKQKVETDNGFHNASTFSLEEEEEPDGGGSSEFTLFPEDL
VAEQLTYMDAELFKKVVPHHCLGCIWSQRDKKENKHLAPTIRATISQFNTLTKCVVSTIL
GGKELKTQQRAKIIEKWINIAHECRILKNFSSLRAIVSALQSNSIYRLKKTWASVPKDRM
LMFEELSDIFSDHNNHLTSRELLMKEGTSKFANLDSNVKENQKRTQRRLQLQKDMGVMQG
TVPYLGTFLTDLTMLDTALQDYIESGLINFEKRRREFEVIAQIKLLQSACNSYCMTSDQK
FIQWFQRQQLLTEEESYALSCEIEAPVDTSATSPKPRKSMVKRLSLLFLGSDVINSSTPT
KEQPKSTPSGSSGESMDSVSVSSCESNHSEGEEGCITPVDTPDEPPKKLSESSSSCSSIH
SMDTTSSGVSSFINPLSSPPVTNSNPKNHKRSISVTSITSTVLSPVYNQQNEDTCIIRIS
IEDNNGNMYKSIMLTSQDKTPAVIQRAMLKHNLDSDPAEDYELVQVISEDKELVIPDTAN
VFYAMNSQVNFDFILRKKNTLDEQVKLRSRTSLTLPRTAKRGCWSSRHSKITL
Download sequence
Identical sequences F7FQQ5
ENSMODP00000009019 XP_007481012.1.35504 ENSMODP00000009019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]