SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009105 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009105
Domain Number 1 Region: 55-152,184-210
Classification Level Classification E-value
Superfamily SH2 domain 6.85e-31
Family SH2 domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 2-74
Classification Level Classification E-value
Superfamily SH3-domain 1.19e-20
Family SH3-domain 0.0000364
Further Details:      
 
Domain Number 3 Region: 154-198
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000834
Family SH3-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009105   Gene: ENSMODG00000007342   Transcript: ENSMODT00000009285
Sequence length 217
Comment pep:known_by_projection chromosome:BROADO5:2:213770552:213879222:1 gene:ENSMODG00000007342 transcript:ENSMODT00000009285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPW
FFGKIPRAKAEEMLGKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRG
DFIQVLDNSDPNWWKGACHGQTGMFPRNYVTPVNRSI
Download sequence
Identical sequences F7B0Q0
ENSMODP00000009105 XP_001369479.1.35504 ENSMODP00000009105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]