SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009125 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009125
Domain Number 1 Region: 828-1270
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.23e-123
Family DNA polymerase I 0.00000275
Further Details:      
 
Domain Number 2 Region: 454-827
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.4e-80
Family DnaQ-like 3'-5' exonuclease 0.0017
Further Details:      
 
Domain Number 3 Region: 1375-1412
Classification Level Classification E-value
Superfamily Zinc finger domain of DNA polymerase-alpha 5.89e-16
Family Zinc finger domain of DNA polymerase-alpha 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009125   Gene: ENSMODG00000007354   Transcript: ENSMODT00000009305
Sequence length 1499
Comment pep:known_by_projection chromosome:BROADO5:4:41462657:41808274:-1 gene:ENSMODG00000007354 transcript:ENSMODT00000009305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPVHSGEPEPESSGVSDSGSSLASRSRREKKSAKGRQEALERLKKAKAGERFKYEVEDF
TSVYDEVDEDQYSRMVQARQDDDWIVDDDGTGYVEDGREIFDDELDDDAFDVSKKGKGDK
ASKDKKNIKKAVVSKPNNIKSMFMASAGKKTTDKVVDLSKDDLLGDILQDLNSSTPQITP
PPVMMLKKKRPTGASLNPFSVQIPKATPLGKNDVPISRRESPVTLVDLKHADYMAKPSDV
KKHKDIEQLHSEVVNCASVMMQQEEASEGEEMIKEEEEDGLMDFEDGDFDEPMEDEEADS
LPKAIKTQEEEKEQEKNVEPESSHLDSFLPDVSCWDKMDQEDESSLRTQEIQVDSNHLPL
VKGADGDQVFLFYWLDAYEDQFNQPGVVFLFGKVWIESAETHVSCCVMVKNIERTLHLLP
REVRIDLATGEKKGNPVTMKDVYQEFDEKTATKYKIMKFKSRKVEKNYAFEIPDVPEKSE
YLEVRYSAELPQLPQDLKGETFSHVFGTNTSSLELFLMNRRIKGPCWLEIKNPQLLNQPI
SWCKVEAMALKPDLVNVVKDIAPPPLVIMSFSLKTMQNAKTHQNEVIALAALIHHSFPLD
KAAPQPPFQSHFCVVSKPNDCIFPYDFKEVINKKNVNIEIAATERTLLGFFLAKVHKIDP
DVIVGHNIYGFDLEILLQRINVCKVPHWSKIGRLKRSIMPKLGGRGGFAERNAACGRMIC
DVEISAKELIRCKSYHLSELVHQILRTERETIPPENIRNMYSDSRHLMYLLENTLKDAKF
ILQIMCELNVLPLALQITNIAGNVMSRTMMGGRSERNEFLLLHAFYENNYIVPDKQNFRK
PQQRLGDEDEDIDGDTNKSKKGRKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQE
FNICFTTVQRVASEDQKITEDEEQEDIPDLPDPDLEMGILPKEIRKLVERRKQVKQLMKQ
QDLNPDLVLQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKEMV
QKMNLEVIYGDTDSIMINTNSTNLEEVFKLGNKVKSEVNKLYKMLEIDIDGIFKSLLLLK
KKKYAALVVEPTSDGKYVTKQELKGLDIVRRDWCDLAKETGNFVIGQILSDQNRDTIVDN
IQKRLIEIGENVTNGSVPISKFEINKALTKDPQDYPDKKSLPHVHVAIWINSHGGKKVKA
GDTVSYVVCQDGSNLSASQRAYAPEQLKKQDNLAIDTQYYLSQQVHPVVARICEPIDGID
AALIATWLGLDPTQFRVHQHYHKDEENDALLGGPAQLSDEEKYRDCERFKFSCPKCGTEN
ICDGVFDGSGTQIEPSLFRCCNIDCKASPMTFTDQLNNKLILDIRRCIKKYYSGWLICEE
PTCQTRTRRLPLQFSRSGPLCQTCMKATLRPEYSDKSLYTQLCFYRYMFDLDSAQEKLIT
DHEKDILRKKEHLFKPTLEAYRKLKSTAEHFLAGSGYSEVCLSKLFADCTVKPLRESQN
Download sequence
Identical sequences F7ADS9
XP_007493462.1.35504 ENSMODP00000009125 ENSMODP00000009125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]