SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009143 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009143
Domain Number 1 Region: 411-537
Classification Level Classification E-value
Superfamily TIMP-like 2.55e-24
Family Tissue inhibitor of metalloproteinases, TIMP 0.047
Further Details:      
 
Domain Number 2 Region: 169-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000272
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 3 Region: 234-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family Laminin-type module 0.039
Further Details:      
 
Domain Number 4 Region: 297-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.009
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000009143
Domain Number - Region: 8-70
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00017
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009143   Gene: ENSMODG00000007369   Transcript: ENSMODT00000009324
Sequence length 537
Comment pep:novel chromosome:BROADO5:6:249445689:249490080:-1 gene:ENSMODG00000007369 transcript:ENSMODT00000009324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDDVFTSPNTWWQSAAGISREEIRLDFETEFYLTHVIVVFRSPRPAAMILERSQDDGHT
WRPYKYFAANCTATFGLQDDLLEEGSPCTSRYSGAIPCTRGEVIYRALTPTNQVDDPYGP
EAQDLLKLTNLRLLLLKRQDCPCQEARLPEKPQRFAHYAIYDLIVRGSCFCNGHGERCQP
ADETENSRSMVHGTCVCRHHTAGLHCERCLPLYNDQPWKPGDGKTSQPNECKKCRCHKHA
ESCHFDPGIWLDSGKRTGGICDNCQHHTEGRHCQKCKPGFYRDWSKPMSSPEVCKPCSCQ
PLGSANEMSHQGFPCHPKTGYCLCKPGVAGPHCDRCLVGYWGFGRNGCHPCNCSGECEPH
TGACLAGHEKAPVLPVPVEGQIPDLDQGLGNDSEGPLRWDDQERGFSALRHPEKCVCKEK
TVGKVRDFCQMKYAYVIKAKILSAYDKGTHAEVWVKVKKILKSSQVKIFRSHQSIYPESW
THRGCTCPILNPGTDYLIAGQEDPRSNKLLVNMNSLVKPWKVYLGKQVTGILRTRCK
Download sequence
Identical sequences F7ACW1
ENSMODP00000009143 ENSMODP00000009143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]