SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009208 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009208
Domain Number 1 Region: 1-133,245-389
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.58e-55
Family CAF1-like ribonuclease 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009208   Gene: ENSMODG00000007420   Transcript: ENSMODT00000009389
Sequence length 533
Comment pep:known_by_projection chromosome:BROADO5:2:442196794:442225066:1 gene:ENSMODG00000007420 transcript:ENSMODT00000009389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGADCFEQKLPMLEELILASDFLGLDIEFTGLRSIYPKGQQTSLFDSPAEWYLKTRRS
IQQFTVCQIGLSMFSNMGRKSNKYLAHSYNFFLFPTTLGIMDSEFSFQASSILFLNQYGF
DYNKFLKNGIPYMNEEQEKKIKQDLLTGNWKVRSTLDKDQMKVVIDEVTRWLEMAQEGDW
MTLPDITGFQAFEVQLVLRQALPTVWTLMKDKGVLVKKVSRQYRWCLENSSRDHDDCRRE
KILLSARGFAVFFQMLVKAKKPLVGHNMMMDLLHLHEKFYRPLPESYEQFKLNIHGLFPV
LIDTKNVTKEIWKELSFPRASNLLEVYEVLNSDLNPTKNSCPVIIHASECIKYVETKYPH
EAAYDAFLCGSVLLKVAHLLLHRSTGGVRLEPTFPQYLGVLAPYVNQVNLIRACISKINF
SGPDSPSSRPPTLILKVKRWPGVDEEQIYYEFKDLCKFDVRRFTRNQFLLMTNKFKDVRI
VLQEYRYHPDLQVMLYRYWRHSPNINCILQICGVVTTWAFLAFILGGSPSHVQ
Download sequence
Identical sequences F7EE59
XP_007484914.1.35504 ENSMODP00000009208 ENSMODP00000009208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]