SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009227 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009227
Domain Number 1 Region: 435-522,685-761
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.83e-22
Family Canonical RBD 0.00028
Further Details:      
 
Domain Number 2 Region: 175-269
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.22e-19
Family Canonical RBD 0.002
Further Details:      
 
Domain Number 3 Region: 310-402
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000114
Family Canonical RBD 0.001
Further Details:      
 
Domain Number 4 Region: 22-104
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000706
Family Canonical RBD 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009227   Gene: ENSMODG00000007436   Transcript: ENSMODT00000009408
Sequence length 764
Comment pep:known_by_projection chromosome:BROADO5:3:357038220:357040514:-1 gene:ENSMODG00000007436 transcript:ENSMODT00000009408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CYYVYLFVCRSLLLWFELSMAVVIRLQGLPVIAGPVDIRHFFSGLNIPDGGVHIIGGEIG
EAFIIFATDEDARRAMSRSGGFIKDSPVELFLSSKTEMQNTIEMKRKRFDRGGRELISGS
KRPGSSSSGTSGVGSLSNLVEAIKKGINKPGYDPSDDPEAGFHTNGTRHGITGPRKETRT
FKSDNRYLFLRGLPYSATEDEVRAFFPGLCVDGIILLKHPTGRNNGDCLVKFATSHDALG
GLQRHRHYMGSRFVEVSPASEQQWIDCGGSADIKDEVHFRSEERSPQRGINDAHSKKRSR
SKSPRRMKRRSRSPHKYGFYVHLKNLSLSVEKRDIKNFFRDTDLASDQIKFLYKDQKRTG
SAFVMFKTLRDYNSALALHKFILFHRQVLIDPISKKTMLKFIECYEKKRSGSVGRERPGH
IPEKTYREGHSGPKLCIYIRNFPFDVTKVEVQKFFAGFSIDEDDVYLLYDDKGVGLGEAL
VKFKSEEQAMKAESLNRRRFLGTEVLLRLISEEQMQEFGVNISSIPSEKMQDHSQTRDRD
EHSHSVDPQGPSVHSFGPPGKFRHPPEDFRQQPDNFRHPPDDFRHPPDRHPPDDFRHPPD
RHPPDDFRHPPDRHPPDDFRQPDNFRPPPDDFMCPPDDFRGPRPFMNFGPPEGEPFGRFD
FGNNNMGGFPEGRFMPDPNFNCGSGRVTPIKIMNLPFKANVNEILDFFHGYGVIPESVSI
QYNEQGLPLGEAIVAMVNYDEAMAAINDLNDRPVGPRKVKLILL
Download sequence
Identical sequences F7DWK0
13616.ENSMODP00000009227 ENSMODP00000009227 ENSMODP00000009227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]