SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009309 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009309
Domain Number 1 Region: 6-212
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.64e-45
Family DBL homology domain (DH-domain) 0.00021
Further Details:      
 
Domain Number 2 Region: 200-331
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000268
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009309   Gene: ENSMODG00000007501   Transcript: ENSMODT00000009490
Sequence length 333
Comment pep:known_by_projection chromosome:BROADO5:6:122727248:122732469:1 gene:ENSMODG00000007501 transcript:ENSMODT00000009490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPGPRCPVSEQRARWERKRGRTARELLETERRYQEQLALVVQYFLCILRAKGTLRPAE
LLAVFGPWESIHIASQELLLHLEAGNWGAGLERFCHHLELYTRFAANEEQSRATLQKRLR
KSKHFRRFVQLQEGRPEFGGLRLVDLLPLPLQRLQQYENLVVALAENTGPDSPDYPQLTK
AAQKLSEAIQHVSAISREQENGRQLHRIQTLLSGRRAKGLTKGRWFLRQGWLLVVPPKGE
PKPRMFFLFSDALLMAKPRSVLHVLYGGTFACRALYPMAQCQLQRIFGHSGGAGGGLLSL
SFPQEKLLLMSTNQESLSRWYHSLTLAISSQRR
Download sequence
Identical sequences F6YX78
XP_007498861.1.35504 ENSMODP00000009309 ENSMODP00000009309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]