SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009501 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000009501
Domain Number - Region: 284-342
Classification Level Classification E-value
Superfamily RING/U-box 0.00151
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009501   Gene: ENSMODG00000007648   Transcript: ENSMODT00000009687
Sequence length 420
Comment pep:known_by_projection chromosome:BROADO5:1:256839645:256970228:1 gene:ENSMODG00000007648 transcript:ENSMODT00000009687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAPGPEDPCAPGKEPRKYGELVVLGYNGALPNGDRGRRKSRFALYKRSKANGVKPSTVH
VISTPQASKVISCKGQHSISYTLSRNQTVVVEYTHDDDTDMFQVGRSTESPIDFVVTDTI
SGSQNNDESQITQSTISRFACRIVCDRSAPYTARIFAAGFDSSKNIFLGEKAAKWKNPDG
HMDGLTTNGVLVMHPKGGFTEESKPGIWREISVCGDVYTLRETRSAQQRGKLVENETNIL
QDGSLIDLCGATLLWRTADGLFHTPTQKHIEALRQEINAARPQCPVGLNTLAFPSINQKD
VVEEKQPWAYLSCGHVHGYHNWGHRSDTEANERECPMCRTVGPYVPLWLGCEAGFYVDAG
PPTHAFTPCGHVCSEKSAKYWSLIPLPHGTHAFHAACPFCATQLVGEQNFVKLIFQGPID
Download sequence
Identical sequences F7FZH7
ENSMODP00000009501 ENSMODP00000009501 13616.ENSMODP00000009501 XP_007472998.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]