SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009543 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009543
Domain Number 1 Region: 400-430
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000628
Family CCCH zinc finger 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000009543
Domain Number - Region: 324-354
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00973
Family CCCH zinc finger 0.0059
Further Details:      
 
Domain Number - Region: 200-222
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0251
Family CCCH zinc finger 0.0049
Further Details:      
 
Domain Number - Region: 231-267
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0534
Family CCCH zinc finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009543   Gene: ENSMODG00000007684   Transcript: ENSMODT00000009731
Sequence length 911
Comment pep:known_by_projection chromosome:BROADO5:2:213183446:213226252:-1 gene:ENSMODG00000007684 transcript:ENSMODT00000009731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEFSLELQTHKQEYETSLDYSPQNPPWAPQHPGQSPHGIPGSCGPFLRWQSPFALGLGR
SNQPQLPAARLASRGCFTFSWRYAGALGSRRGPRRLNNKRGAAKREEDRTMSKGPGPGGS
AASSAPPAATAQVLQAQPEKPQHYTYLKEFRTEQCPLFVQHKCTQHRPYTCFHWHFVNQR
RRRSIRRRDGTFNYSPDIYCTKYDETTGLCPEGDECPFLHRTTGDTERRYHLRYYKTGIC
IHETDSKGNCTKNGLHCAFAHGPHDLRSPVYDIRELQAMEALQNGQTASEGSIEGQSAVA
ASHAMIEKILSEEPRWQDTTYVLGNYKTEQCKKPPRLCRQGYACPYYHNSKDRRRSPRKH
KYRSSPCPSVKHGDEWGDPGKCENGDACQYCHTRTEQQFHPEIYKSTKCNDMQQSGSCPR
GPFCAFAHVERMPEPYGSFHCTRVMTQSFFGKANKSPLRILATHPLILCRNSSLGSPSNL
CGSPPGTIRKPQNLEGISFPGETNPAPGSYKKAPGFEREDQVGAEYLKSFKCQAKIKPHS
LEHRSQEQPLLQPKQDILGILPVGSPLTSSISSSITSSLAATPPSPAGPSSVPGMNANAL
PFYPTSDTVESVIESALDDLDLNEFGVAALEKSFDNSTVPHPGGIMIGGSLLQSSAPVNI
PGSLGSSASFHSASPSPPVSLSSHFLQQPQSHLSQSENTFLGTSASHGSLAGLNGMNSSI
WEHFASGNFSPGTSPAFLSGPGAAELARLRQELDEANGTIKQWEECQLARSSACDAWKKE
AEEASERASAAGMECELAREQRDALEMQVKKLQEELERLHTGQDPQTLCSFSDLEALSLS
TLYSLQKQLRANLERVEKVVFQMQSPAKCLKCQEQHRVVLQCQHTVLCELCAEDSECPVC
NPSCARPPLQS
Download sequence
Identical sequences F7FN62
ENSMODP00000009543 ENSMODP00000009543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]