SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009664 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009664
Domain Number 1 Region: 511-807,838-886
Classification Level Classification E-value
Superfamily DNase I-like 6e-74
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.000000596
Further Details:      
 
Domain Number 2 Region: 877-967
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000527
Family Canonical RBD 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009664   Gene: ENSMODG00000007783   Transcript: ENSMODT00000009855
Sequence length 1490
Comment pep:known_by_projection chromosome:BROADO5:2:439869733:440024774:1 gene:ENSMODG00000007783 transcript:ENSMODT00000009855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSKGLRLLRRLEPPGEISILLEARSRQDCLLFEAGTVATLTPEEKEVIKGQYWKLIDA
YGCLGELRLISGGTQLSFLVLVTGCTSVGRILDAEIFKITTVDFCPLQDDVKEEDRLTAL
KKILNSGMFYFSWPNAGSNFDLTVRAQKQGDDNYELGNSFFWNQLLHVPLKHYQVNCSDW
LLKVICGVVTIRTVYASHKQAKACLISRISCERAGARFHIRGVNDDGHVSNFVETEQTIY
MDDGVSSFVQIRGSVPLFWEQPGLQVGSHHLKLNRGLEANAPAFDRHMMLLKEQYGKQVI
VNLLGSRGGEEVLNRAFKKLLWASFHAGDTPMINFDFHQFAKGGKIEKLENLLRPQLKLH
WDEFDVFAKGENVIPRFQKGTLRMNCLDCLDRTNTVQCFIALEVLHLQLESLGLNSKSVI
ERFVESYKAMWSLNGHNLSKVFTGSRALEGKAKVGKLKDGARSVSRTIQSNFFDGVKQEA
IKLLLVGDVYKDEYADKGRMLLDGTALLVTPRILKAMSERQSEFTNFKRVRIAMGTWNVN
GGKQFRSNLLGTGELTDWLLDSPKLSGATEFQDDSSPADIFAVGFEEMVELSAGNIVNAS
TTNRKMWGEQLQKAISRSHRYILLTSAQLVGVCLYIFVRPYHVPFIRDVAIDTVKTGMGG
KAGNKGAVGIRFQFHSTSFCFICSHLTAGQSQVKERNEDYKEITQKLSFPMGRSVFSHDY
VFWCGDFNYRIDLTYEEVFYFVKRQDWKKLLEFDQLQLQKSSGKIFKDFHEGTINFGPTY
KYDVGSEAYDTSDKCRTPAWTDRVLWWRKKHPLDKTAGELNLLDNDLNVDSKIKHTWSPG
ALMYYGRAELQASDHRPVLAVVEVEVQEVDVDARERVFQEVSSFQGPLDATVVVNLQSPT
LEEKNEFPEDLRAELMQTLGNYGTIILVRINQGQMLVTFADSRSALNVLDVDGMKVKGRA
VKIRPKTKDWLKGLQEEIVRKRDSIVSMSPTANSCLLEENFDFSSLDYESEGDILDEDED
YLIEEQNPTFLPDPELSGDDYSEASSSSTAGAPPSKSPALTKKKSRPYKDDADLAELKQE
LEAVGDFRHRSPSRSLSVPNRPRPPHPPQRPPPPTGLMVKKSASDASISCGTHGQYSILQ
TAKLLPGAPQQPPKARTGISKPYNVKQIKTTNAQEAEEAIRCLMEAKGGTQEEALNAVFL
RNQVSTKPEPLSNVSKPGSSQTSQLLPHRPAPRVPVIKKPTLRRTGKSLSPEEQFEQQVI
QFTLGSPEPSLESHSLAVPPRVAPIPKPRTLQPGRAVERRLSSEAQAEGEATVPPSLETA
SHVPKVPPRRKKSAPAAFHLQVLQSSHLLLQDGACCGSNNNNNHRYDSRAGDPPDSGPPA
PQADLVGPAPAPGLRADNTKAASLLGEHQDPFLSLLHHPKMLDAGWFTRSAEPLGPVTPC
LERESPKPAQGGAPAARVGPLHKDLEHWSIFSDDEDKRTALQLFDPLAKT
Download sequence
Identical sequences F7AW70
ENSMODP00000009664 XP_001381377.1.35504 ENSMODP00000009664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]