SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009708 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009708
Domain Number 1 Region: 297-345
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000911
Family UBA domain 0.012
Further Details:      
 
Domain Number 2 Region: 16-197
Classification Level Classification E-value
Superfamily Rhomboid-like 0.000000000000876
Family Rhomboid-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009708   Gene: ENSMODG00000007817   Transcript: ENSMODT00000009899
Sequence length 345
Comment pep:known_by_projection chromosome:BROADO5:7:98366505:98686980:-1 gene:ENSMODG00000007817 transcript:ENSMODT00000009899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTSTGSSGLYKAPLSKSLLLVPSTLSILLALLFQHYQKFFVYNLQAVKNDLQIWRLICG
RIICLDLKDTFCSSLLIYNFRIFERRYGSRKFASFLLGSWILSALFDLILVEAFQYSFAI
TASNLPSGFLGPVFALFVPFYCSIPRVQVTQILGQFSITNKTLIYILGLQLLTSGTHIWV
VATSGLIAGMCYTNSVLKVHQVLCIPRWMAKLFSWTLEPIFSSSEPTNEIRIGMGATVDI
QRQQRMELLDRQLMLSQFVHVRRQRRHQGRIINWNRFFPTLRQRRNANAPDVRQSEQEVA
APPLEVSEEQVARLMEMGFSRVDALEALRASNNDLNVATNFLLQH
Download sequence
Identical sequences F7ETS7
ENSMODP00000009708 XP_007501413.1.35504 13616.ENSMODP00000009708 ENSMODP00000009708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]