SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009807 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009807
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.55e-22
Family Canonical RBD 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009807   Gene: ENSMODG00000007884   Transcript: ENSMODT00000009999
Sequence length 596
Comment pep:known_by_projection chromosome:BROADO5:8:12695340:12702804:-1 gene:ENSMODG00000007884 transcript:ENSMODT00000009999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KIFVGNVSAACTSQELRSLFERHGPVIECDVVKDYAFVHMEKEADAKAAIEQLNGKEVKG
KRINVELSIKGQKKGPAGLAAPGEKAKKPGAGDTAFPGTGGFSATFDYQQAFGNSTTGFD
GRPRQPSPPFYGRDRSPLRRSPPRASYVTPLTAQPATYRAQPSVSLGAAYRAQPSASLGV
AYRTQPMAAQAASYRAQPSVSLGAPYRAQLASPGSQPGGASSLGPYGGAQPSASALTSYG
AQSAAASSLTSYGAQASSLASYGNQPASYGVRAAASSYNAQSAASSLTSYGAQAASYGAQ
PATSSLAYGAQAASYNAQPTAASYNAQPTAASYNAQSGPYAAQPAASYSAQPAAYVAQPA
TAAAYAAQPAAYAAQAAGPLAGSYGAQPVVTAQLNAYGAQATMGLSGSYGAQSAAATGSY
GAAAAYGAQPTAAALAAPYRTQSSAPLGSSYTAQQQPPQPAAASYRGQPGATYEGAGQPS
AAYLSLSQGAVANAATSTPPPYERTRLSPPRDSYDDPYKKAAAIMSKRYGSNRRLAELSD
YRRLSDSQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYSEYLRAAQMHSGYQRRL
Download sequence
Identical sequences F6ZH16
ENSMODP00000033056 ENSMODP00000009807 13616.ENSMODP00000009807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]