SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009929 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009929
Domain Number 1 Region: 396-565
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.1e-40
Family DBL homology domain (DH-domain) 0.00068
Further Details:      
 
Domain Number 2 Region: 606-735
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000821
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009929   Gene: ENSMODG00000007975   Transcript: ENSMODT00000010121
Sequence length 845
Comment pep:known_by_projection chromosome:BROADO5:2:254014909:254021930:-1 gene:ENSMODG00000007975 transcript:ENSMODT00000010121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAHSLPPATPPSQKPPRVIRPQPPSRLRINSPPGSLFNGPSHQEAAKPPTSPDPLVLTS
LSPLCDSLPTSTKSLIFPSTPSPKSSSFSLTLPDSSSSPPSPHILGPGLPKLLPPFPAPR
TNSSPEPISPSQSSSPKFGSLPHHPSASGTVRRLAGKFEPGSTVGDQVGEAPFPDPQGGV
DENGERKDCHDPVARSGPQENGCLDTPLSCPPCCPCLCHLAHPSLELKWVSVGDSEEAPR
APPRCPSRSLSSPTSNKSTSVVLTSYRSMVEHKVLPPLKPPKPAWARKEVTCPEHTPQTN
STVLPKDGTHPGIGTWEWDRSWGILGNGSFISLSLHRDQELQALNEQDWGLPLQDEPLYQ
TAVLAEELWGVGKDGKLLPTNLGEPSEPRNTLWQELPTVRESGLLKTLSPEERRMQESLF
EVVTSEASYLRSLQLLMDTFVLSASLRDTLTPRDHHTLFSNVHRVQSVSERFLGVLLSRV
RSSPHISDLCDVVHAHAEGPFSVYVDYVRNQQYQEETYRRLMETNMRFSAELHRLQSLPQ
CQKLPLPSFLLLPFQRITRLRMLLQVQGILCREGTGGRRGEGDTGLSPQIIERCSAEVGR
MKQTEELIRLSQRLRFHKVKALPLVSWSRRLELQGELMELGSKKGRSLFNSRPRLTPLCL
LLFSDLLLITQPKSGQRLHVLDYAHRSLVQAQPVPDPSGPPTFRLSLLSNHQGCPTHRLL
QTSSLSDMQRWLGAFPIPGPPPCSPDTIYEEWDCPQALSADSHVIAKTKDLSLEPGDLVN
KLHKGPEAWLKSIHGAYAAQLASEVTGEHIRRKNLRQQKQLLQETGNVQTTPPLSKGSQQ
PPALT
Download sequence
Identical sequences F7DQM9
ENSMODP00000009929 ENSMODP00000009929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]