SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009994 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009994
Domain Number 1 Region: 185-319
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.16e-35
Family Canonical RBD 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009994   Gene: ENSMODG00000008029   Transcript: ENSMODT00000010186
Sequence length 619
Comment pep:known_by_projection chromosome:BROADO5:4:288615377:288699060:-1 gene:ENSMODG00000008029 transcript:ENSMODT00000010186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTKRLLGVDQNETFLQSSGQGQRCAGAEGAAPQHTAGAGLGLGNVTTSCSFWQRHFESA
VAAVWVCEAGVRRLVQFINLPGFLSHPTDNSPSPPLTYSKFRGAIMLRGNLKQVRIEKNP
ARLRALESAAGESETAAAAAMALALAGEQAPPPSAPQEDHQEEEMGFTIDIKSFLKPGEK
TYTQRCRLFVGNLPTDITEEDFKRLFERYGEPSEVFINRDRGFGFIRLESRTLAEIAKAE
LDGTILKSRPLRIRFATHGAALTVKNLSPVVSNELLEQAFSQFGPVEKAVVVVDDRGRAT
GKGFVEFAAKPPARKALERCGDGAFLLTTTPRPVIVEPMEQFDDEDGLPEKLMQKTQQYH
KEREQPPRFAQPGTFEFEYASRWKALDEMEKQQREQVDRNIREAKEKLEAEMEAARHEHQ
LMLMRQDLMRRQEELRRLEELRNQELQKRKQIQLRHEEEHRRREEEMIRHREQEELRRQQ
EGFKPNYLENREQEMRMGDLGPRGAINMGDAFSPAPAGNQGPPPMMGMNMNNRGTIPGPP
LGPGPALGPEGAANMGTPMMPDNGAVHNDRFSQGPPSQMGSPMGSRTATNGVVCHLSYEG
KGINTNMNIAEDHPSWSTF
Download sequence
Identical sequences F7CKP3
ENSMODP00000009994 ENSMODP00000009994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]