SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010024 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010024
Domain Number 1 Region: 76-170
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.75e-23
Family Canonical RBD 0.022
Further Details:      
 
Domain Number 2 Region: 3-74
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.01e-21
Family Canonical RBD 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010024   Gene: ENSMODG00000008056   Transcript: ENSMODT00000010216
Sequence length 366
Comment pep:novel chromosome:BROADO5:8:12683416:12687919:-1 gene:ENSMODG00000008056 transcript:ENSMODT00000010216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLFIGNLPREATEQEIRALFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKL
HGVNINVEASKNKSKASTKLHVGNISSACTNLELRAKFEEYGPVIECDIVKDYAFVHMER
AEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPVDRT
GRMADLAEQYTEQYGAVRAPYAMGYGESVYYSNAYGALDAYYKRCRVRSYEAIAAAAASA
YNYAEQTLSQLPQVQNPAMTSHLTTTSVDPYDRHLLPTSGAAAATAAAAAAAAAAVTAAS
TSYYGRDRSPLRRAPTVPTVGEGYGYGHENELSQASAAAAAARNSLYDMARYEREQYADR
ARYSAF
Download sequence
Identical sequences F6Z9I7
13616.ENSMODP00000010024 ENSMODP00000010024 ENSMODP00000010024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]