SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010059 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010059
Domain Number 1 Region: 375-560
Classification Level Classification E-value
Superfamily NTF2-like 8.77e-64
Family NTF2-like 0.0000000439
Further Details:      
 
Domain Number 2 Region: 114-205
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.41e-35
Family Non-canonical RBD domain 0.0000162
Further Details:      
 
Domain Number 3 Region: 209-364
Classification Level Classification E-value
Superfamily L domain-like 2.35e-32
Family mRNA export factor tap 0.000000295
Further Details:      
 
Domain Number 4 Region: 557-624
Classification Level Classification E-value
Superfamily UBA-like 7.14e-25
Family TAP-C domain-like 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010059   Gene: ENSMODG00000008085   Transcript: ENSMODT00000010253
Sequence length 625
Comment pep:novel chromosome:BROADO5:5:300723017:300729936:-1 gene:ENSMODG00000008085 transcript:ENSMODT00000010253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCLGSLFFTPEHDDRVGGSFPQRRKKGRGPFRWKYGETNSRPRNRGGPGPRAAHPAEEDG
DVAMSDAQDGPRARYTPYNSRPNRRGGDNWHDRDRIHVTVRRDRAGQDRGATAGGSLDAV
PKNWFRITIPYGRKYDKTWLLNSLQSKCSVPFTPVEFHYENTRAQFFVEDASTAMAIKAV
NHKIVDRENRRITVIINPSAPPQSVLNELKPEQVEQLKFVMSKRYDGSQQALDLKGLRTD
PDLVAQNIDVVLNRRNCMSASLRIIEENIPELLSLNLSNNRLYRLDDLSDIVQKAPNLKI
LNLSGNELKSERELDKVKGLKLDELWLMGNPLCAAFRDQSFYISAIRERFPKLLRLDGHE
LPPPIAFDVEAPTTLPPCKGSYFGSENLKAMVLYFLQQYYSVYDSGDRQGLLDAYHDQAC
CSLSIPFTSQNPARGSMSEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHD
VNSFVVDICAQTETLLCFAVHGVFKEVDGKSRDSVRAFSRVFIAVPSNNAARLCIVNDKL
FIRNATTDEIRRAFVMPAPTPSSSPVPTLSPEQQEMLQTFSTQSGMNLEWSQKCLQDNDW
DFARAAHVFTQLKAGSKIPEVAFLK
Download sequence
Identical sequences F6YJ26
ENSMODP00000010059 ENSMODP00000010059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]