SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010181 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010181
Domain Number 1 Region: 150-197
Classification Level Classification E-value
Superfamily RING/U-box 8.32e-17
Family RING finger domain, C3HC4 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010181
Domain Number - Region: 33-99
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.0785
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010181   Gene: ENSMODG00000008191   Transcript: ENSMODT00000010377
Sequence length 231
Comment pep:known_by_projection chromosome:BROADO5:5:250276360:250304388:-1 gene:ENSMODG00000008191 transcript:ENSMODT00000010377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQQISDQTQMVINKLPEKVTKHISLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHL
LFEVQPRSDSSAFWKVLVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQ
GPTTSEGTAENLSSVSSCQASIWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCID
KWSDRHRNCPICRLHLTGVNDSWVVSDAPTEDDMANYILNMADEAGQPHVP
Download sequence
Identical sequences F7DJU9
13616.ENSMODP00000010181 XP_001379486.1.35504 ENSMODP00000010181 ENSMODP00000010181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]