SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010225 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010225
Domain Number 1 Region: 9-101
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.98e-29
Family La domain 0.0000118
Further Details:      
 
Domain Number 2 Region: 102-196
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.7e-18
Family Canonical RBD 0.00000717
Further Details:      
 
Domain Number 3 Region: 227-323
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000204
Family Canonical RBD 0.00000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010225   Gene: ENSMODG00000008227   Transcript: ENSMODT00000010423
Sequence length 405
Comment pep:novel chromosome:BROADO5:4:179460320:179469763:1 gene:ENSMODG00000008227 transcript:ENSMODT00000010423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENGDSEKMTDLESKICQQIEYYFGDFNLPRDKFLKEQIKIDDGWVPLEIMIKFNRLSK
LTKDFDVIRSALKKSKAELMEVSEDKTKIRRSPSKPLPEVTDEYKNEVKNRSIYVKGFPT
DATLDDIKEWLEGKGQVQNIQMRRTLHKAFKGSIFAVFDSVESAKKFIETPGQKYKDTEL
LILFKEDYFAKKNEERKQNKVEAKAKAKQEQEEKQKQAEEAELASLLFLFSKELDDQTCR
EDLHTLFSNHGEIKWIDFIRGAKEGIILFKEKAKEALEKANEANSGNLKLRNKDVTWEVL
EGETEKEALKKIIEDQQESLNKLKSKAFEIIKIIFIGRKFKGKGRGGKAVQGTPNKGKIQ
FQGKKTKFDSDEEQENGSLKRTREEPEKEEPAPKQLKTENGAGDQ
Download sequence
Identical sequences F6ZY45
ENSMODP00000010225 13616.ENSMODP00000010225 ENSMODP00000010225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]