SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010286 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010286
Domain Number 1 Region: 683-848,897-1043
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.5e-82
Family Protein kinases, catalytic subunit 0.00000169
Further Details:      
 
Domain Number 2 Region: 95-135
Classification Level Classification E-value
Superfamily UBA-like 7.98e-16
Family UBA domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010286   Gene: ENSMODG00000008278   Transcript: ENSMODT00000010485
Sequence length 1123
Comment pep:known_by_projection chromosome:BROADO5:4:290134519:290194222:-1 gene:ENSMODG00000008278 transcript:ENSMODT00000010485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPKTFPATTYSGNSRQRLQEIREGLKQPPKSSGQGLPVGPGSDTSLDTKILVVKDAARQ
QQMKPTPKFGPYQKALREIRYSLLPFANESSAVDVNRQMLQELVKVGCDQEMAIRALKQT
GSKNIEAALEYISKMGYVDPRSEQIVRVIKQTSSGKGSVPNNVSRRPSFEGTSDSFPSYH
MSSAGYEGPGFGVEGANMLSDVPRQYVDYLLSSPPPSALTPAGPRPLGVSPHTTGGSHQH
QSKAYPAGLEAPGINYPVANHSSQALQLQPPHGSNNPHYGRAHMAVQGEPMGYGIQRSPS
FQNKMQQEGGYANLPNKGQVVQNSSGHSFQPAAASLYLTHSHHKQSSPSSHQMHMMAARG
PAFANDFPDNPPPSLLTPSRNSLNMDLYDMNNPAGPGWQASTLSRRDSLQNPSLEASPRA
HVSFRPDSHVPSRTNSFNNHQQPPVAVSIRPGPAGKTDASISSPNTITAVTSAHILHPVK
SVRVMRPEPQTAVGPSHPAWLPPKTPAVEGLEMMEQHPLPKGSPSAYSLEVDYGAQEPRC
PPPPYPKHLLLPNSSEQFDINSLCVGVEQSLRGVPNSVNSQAEDGIERNDKSSKNSKGEK
SGKDIKQIQTSPVPVRKNSKDEEKRESRIKSYSPFAFKFYMEQHVENVLKTYQQKINRRL
QLEQEMAKAGLCEAEQEQMRKILYQKESNYNRLKRAKMDKSMFVKIKTLGIGAFGEVCLA
FKVDTHALYAMKTLRKKDVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQDKDNLYFVM
DYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIESVHKMGFIHRDIKPDNILIDHDGHI
KLTDFGLCTGFRWTHNSKYYQKGSHIRQDSMEPSDLWDDVSNCRCGDRLKTLEQRAKKQH
QRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVGVILFEMLVGQPPFLAPTPTETQLKV
INWESTLHIPTQVKLSPEASDLITKLCCAAENRLGRNGADEIKAHPFFSSMDFSSDIRKQ
PAPYVPKISHPMDTSNFDPVDEDGPWNDVSGDSTKAWDTLTSSNSKHTEHAFYEFTFRRF
FDDNGYPFRCPKPSGIEATQSQNSDIENKDMVDPTGDCQPVYV
Download sequence
Identical sequences F6YIY3
ENSMODP00000010286 XP_007495268.1.35504 ENSMODP00000010286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]