SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010327 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010327
Domain Number 1 Region: 6-140
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.93e-36
Family Cap-Gly domain 0.00089
Further Details:      
 
Domain Number 2 Region: 121-360
Classification Level Classification E-value
Superfamily L domain-like 1.87e-27
Family Internalin LRR domain 0.026
Further Details:      
 
Domain Number 3 Region: 439-527
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.67e-22
Family Ubiquitin-related 0.000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010327   Gene: ENSMODG00000008312   Transcript: ENSMODT00000010527
Sequence length 527
Comment pep:known_by_projection chromosome:BROADO5:2:154442664:154570542:-1 gene:ENSMODG00000008312 transcript:ENSMODT00000010527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSVPSNVIGRRIDVNGELATVRYFGNVPPIAGLWLGVEWDNPQRGKHDGSHEGTIYFK
CRHPTGGSFVRPNRVNFGVDFLTAVKNRYGLEKPKEEDGNEMIVIGNKTVETVGFDSIKK
LQSQLNKLQEVSVWGSAVCCAGDRGKIAQTCPNIKRIDLSKNLLSEWDEVTLIADQLKYL
GVLNLSENKLKFPCDSPSPSYTFSALKILVLNRTGITWTEVLWCAQGWPVLEELYLASNN
ITISERPTDILQTLKLLDLSNNHSVDGNQLFLIAYLPRLEQLVLSDNRISTLHFPDVEIG
CKTSMFSSLQYLVINGNQISQWSSINELDKLKSLQSLSCTHNPLTEGNKDLQTIRQLIIA
KIGQLKILNKCEILPEERRGAELDYRKTFGSEWKKAGGHQDPDKNKPNNEFIIAHPRYQL
FCLKYGAPEDGELKPQQPFMLKNQLLTLTIKCPNQPNQKVLVKQLPESMTIQKVKGFLSR
LLKVPGSELKLSYESPKMEGKEIELENDQQPLQFYSVESGDCVLVRW
Download sequence
Identical sequences F7FGW4
13616.ENSMODP00000010327 ENSMODP00000010327 ENSMODP00000010327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]