SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010383 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010383
Domain Number 1 Region: 9-49
Classification Level Classification E-value
Superfamily UBA-like 0.000000383
Family TAP-C domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010383   Gene: ENSMODG00000008352   Transcript: ENSMODT00000010584
Sequence length 165
Comment pep:known_by_projection chromosome:BROADO5:2:212430589:212442236:-1 gene:ENSMODG00000008352 transcript:ENSMODT00000010584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNMEELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQ
MMCTPSNTPATPPNFPDALAMFSKLRASETLQSSNSPMTAMACSPPANFSPFWASSPPSH
QAAWIPPSSPTSQPPPPPPPSAHVAPWAQQGASQQKAVAAMDGQR
Download sequence
Identical sequences F7EK66
ENSMODP00000010383 13616.ENSMODP00000010383 ENSMODP00000010383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]