SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010490 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010490
Domain Number 1 Region: 290-373
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.82e-26
Family Canonical RBD 0.0013
Further Details:      
 
Domain Number 2 Region: 187-285
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000793
Family Canonical RBD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010490   Gene: ENSMODG00000008436   Transcript: ENSMODT00000010696
Sequence length 439
Comment pep:known_by_projection chromosome:BROADO5:2:154885362:154906139:1 gene:ENSMODG00000008436 transcript:ENSMODT00000010696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVGKMKRKKKKPTQDRKTMEDKGNSSSSGDYQVGQVASSLFQNKPLKRVTSHLASLFD
SSAPQVQQPIYVAAREANSKKRKHNEDENEFHSQRTCAAVEQMPTKRIRVKKELSGDKRL
ANRESALMCADLEEEKEEKMQAKQIKNRKISQVSNNGKTTNGKGVDNSDYSFEVNKRKKI
QVNEAEEKIKNKRTVFVGNLPVTCKKKELKSFFKEYGQIECVRFRSLIPAKSTLSKKIAA
IKREVHPEQKSINGYVVFKEESAAEKALKRNGAQIAEGFPVRVELISDTPLRGKRSVFVG
NLPYKIEEAAIQEHFSDCGSVLAVKIVRNKVTGVGKGCGYVLFENTDAVQLALRLNNSEL
MGRKLRVKRYVNHEKVKPPHAPSKILENSTKFKQKLNFPSKNTGQYSENTFAGEKANPLK
KKKKWQKSGKSRKRIEKHK
Download sequence
Identical sequences F7AKF5
ENSMODP00000010490 ENSMODP00000010490 13616.ENSMODP00000010490 XP_007481654.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]