SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010502 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010502
Domain Number 1 Region: 27-115
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-21
Family Canonical RBD 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010502
Domain Number - Region: 131-174
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.0759
Family Tubulin chaperone cofactor A 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010502   Gene: ENSMODG00000008447   Transcript: ENSMODT00000010708
Sequence length 220
Comment pep:novel chromosome:BROADO5:1:86341061:86341789:-1 gene:ENSMODG00000008447 transcript:ENSMODT00000010708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAFVTGPTKLQIEFQKHVASVRKCGANKPEKLSSGVVYLGHLPRGLYEPQLKEYFTQFGT
VKRLMLSRSKKTRNSKGYGFLEFESDDVAKIVADRMNNYLFCERLLKCNFVPPEKVHEEL
FKGCEIPFAKPSHLAVKRYNKERTYKEKIRMKKQFKKKENKLQKRLAEKGIDYTFPKLEL
PKKEKMNVSDTALDTVASQGATPICSPTFLERRKAQAVEM
Download sequence
Identical sequences F7GF12
ENSMODP00000010502 13616.ENSMODP00000010502 ENSMODP00000010502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]