SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010545 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010545
Domain Number 1 Region: 442-518
Classification Level Classification E-value
Superfamily RING/U-box 1.14e-24
Family Variant RING domain 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010545   Gene: ENSMODG00000005530   Transcript: ENSMODT00000010751
Sequence length 531
Comment pep:known_by_projection chromosome:BROADO5:1:245601244:245603649:1 gene:ENSMODG00000005530 transcript:ENSMODT00000010751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSSAQVASSRRQSCYLCDLPRMPWAMIWDFTEPVCRGCVNYEGADRLTAVEQRSRFEYP
PPPGSLGGSGGGGHAARLPNGLGGPNGFPKQSPEDGPPELNRQSPNSSSSRRGAHGGLVT
GLPPASGSGGGGGGPLNVPPNLLPQTLLNGPGAAVLPPPPPHGLGSRPPPQGSNVGGGGG
PSCLGGTTLAAGSASSSSSSSSSTSSSSSEACGGGKRPGSVSSTDQERELKEKQRNAEAL
AELSESLRNRAEDWASKPKMVRETLLTLAGCTPYEVRFKKDHSLLGRVFAFDAARAIASS
RGGASGLRKRKASPEPPDSAEGALKLSEEQQRQQWMATQSEALKLTMSAGGFGANGQSPM
AALMSVADTLGNAHSPKDGSSVHSTTATRRNSSSPVSPASVPAQRRLASRNGDINLQVAP
PPPSAHPGMDQVHPQNIPDSPMANSGPLCCTICHERLEDTHFVQCPSVPSHKFCFPCSRE
SIKAQGATGEVYCPSGEKCPLVGSNVPWAFMQGEIATILAGDVKVKKERDS
Download sequence
Identical sequences F7G4D3
ENSMODP00000010545 ENSMODP00000010545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]