SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010561 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010561
Domain Number 1 Region: 182-426,482-565
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.32e-94
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000142
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010561
Domain Number - Region: 701-763
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000531
Family Ubiquitin-related 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010561   Gene: ENSMODG00000008494   Transcript: ENSMODT00000010767
Sequence length 1374
Comment pep:known_by_projection chromosome:BROADO5:5:251880439:251980740:1 gene:ENSMODG00000008494 transcript:ENSMODT00000010767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPGEENQLVPKEDMFWRCRQSIFDEMKKKFSQIENAAEEPRVLCIIQDTTNSKTVNERI
TLNLPASTPLRKLFEDVANKVGYVNGTFDLVWGNGISATDMPLDHTSDKSLLDTNFEPGK
KNFLHLTDKDGEQPQILSEDSSAVDDSVQDRFIGPLPREGSVGSTGDYVSQSYSYSSILN
KSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFV
LLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELY
QGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQ
YFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTFI
DIEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSNDDGVDEGICLESSSGTEKITKPGLE
KNSLLYELFSVMVHSGSAAGGHYYACIKSFSDEQWYSFNDQHVSRITQEDIKKTHGGSSG
SRGYYSSAFASSTNAYMLIYRLKDPSRNAKFLEVNDYPEHIKSLVQKEKELEEQEKRQRE
IERNTCKIKLFCMHPVKQVMMENKLEVHKDKTLKEAVEIAYKMMDLEEVIPLDCCRLVKY
DEFHDYLERSYEGEEDTPMGLLLGGVKSTYMFDLLLETRKPDQVFQSYKPGEVMVKVHVV
DIKTESVAPPVSVRAYLNQTVTEFKQLISKAIHLPAETMRIVLERCYNDLRLLNVSSKTL
KAEGFFRSNKVFVESSESLDRQMAFTDSHLWKLLDRHANTIRLFVLLPEQSPGSHSKRTA
YQKAGGDSGNVDDACERVKGPLGSLKSVEAILEESTEKLKSLSLQQQQDGDNGDSSKSTE
TSDFENIESPLNERDSSGSVDNRELEQQIQTSDPENFQSEERSDSDVNNDRSTSSVDSDI
LSSSHSSDTLCNADSAPVPLANGLDSHSITSSRRSKANEGKKETWDTAEEDSGTDSEYDE
SGKSRGETQYMYFKAESYAADEGSGEGHKWLMVHVDKRITLAAFKQHLEPFVGVLSSHFK
VFRVYASNQEFESVRLNETLSSFSDDNKITIRLGRALKKGEYRVKVYQLLVNEQEPCRFL
LDAVFAKGMTVRQSKEELLPQLREQCGLELSIDRFRLRKKTWKNPGTVFLDYHVYEEDIN
ISSNWEVFLEVLDGVEKMKSMSQLAVLSRRWRPTDMRLDPFQEVVLESSSVDELREKLCE
ISGIPLEDIEFAKGRGTFPCDISVLEIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKT
EELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
Download sequence
Identical sequences F7FTT0
ENSMODP00000010561 ENSMODP00000010561 XP_016278918.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]