SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010644 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010644
Domain Number 1 Region: 431-664
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.07e-35
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 128-283,428-511
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.58e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.073
Further Details:      
 
Domain Number 3 Region: 1069-1102
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000228
Family LIM domain 0.0076
Further Details:      
 
Domain Number 4 Region: 1103-1131
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000195
Family LIM domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010644   Gene: ENSMODG00000008560   Transcript: ENSMODT00000010852
Sequence length 1992
Comment pep:known_by_projection chromosome:BROADO5:5:252154589:252430482:1 gene:ENSMODG00000008560 transcript:ENSMODT00000010852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQYSATSKQRCNNFSSIPWYSTQSFLLGSSCLILSTNYHQNMGENEDEKQSQAGQIFEN
FVQASTCKGTLQAFNILIRHLQLDPSDHRNFYSKLKSKVTTWKAKALWNKLDKRGTHKEY
KRGKSCMNTRCLVVGGGPCGLRTAIELAYLGAKVVVVEKRDTFSRNNVLHLWPFTIHDLR
GLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVNIEFVKVLEPPEDQENQKV
GWRAEILPADHSLSDFEFDVIIGADGRRNTLEGFRRKEFRGKLAIAITANFINRNTTAEA
KVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDSTHYFVMTAKKQSLLDKGVIVNDY
VDTELLLGSENVNQDCLLSYAREAADFATNYQLPSLDFAMNHYGQPDVAMFDFTSMYASE
NAALVRERQSHQLLVALVGDSLLEPFWPMGTGCARGFLAAFDTAWMVKSWEQGIPPLEIL
AERESLYRLLPQTTPENISKNFEQYTLDPGTRYPNLNSNCVRPHQVKHLYITTELHHLPL
ERFGSIRRSVSLSRRESDIRPNKLLTWCQKQTEGYQHVSVTDLTTSWRSGLALCALIHRF
RPELINFDSLNEEDAIENNQLAFDIAEREFGIPPMTTGKEMASSQEPDKLSLVMYLSKFY
ELFRGTPLRAVDSLGKNYGENGDLSLAKSSIFNNYLNLTFPRKRTPRVENLTEENDMNKR
RRKGLDNLEEPSSFSSRSIGSSREYGISREGMNQNKVKSMANQLLAKFEENARNPSFLRQ
EQALSNLGKPVLHSSAGPPVNSHFAKPEDPTPSPSPPLKRQFQALAKTEQVLREAKQASA
SDCLTRPSRARAKSDLQHPQAGSMAPLPSAYPGAFALVGALRRLQNVEEKIHQKRAQNLA
NREFHKKNIKEKAAHLASMFASEDFPQNKLLTKGLSHPPSLPSSCLSSRDSTDTSFSSSV
DSSSSDRKSFVPGAPGKPNPAPKKAYKQKLFQPDPGQMTVGKVSRGIGAVAEVLVNLYMN
DHRPKTQAASPDRRKAMDQTSLPLNSSISPTGASPGWNHQGSLRKEFPQNLGGSDICYFC
KRRVYVMERLSAEGHFFHRECFRCEVCSTTLRLAAYAFDADEGKFYCKTHFIHCRTNSKQ
RKRRAELKRQEEEEAQEKQQEVKWSDPSPEILGPAVNSREASPPDEPTSPKKPKSIPGPC
DADGQRGLFPAEWTSVKIGPKGEGNEDDVLAICVMVTSDGSSSETESDSGDNSSQMQFSE
QKTLKSQQLPCPKPFRRQVSLMVPQNRRPGTGCPEESKVANDLTSPNSKKSVLSSKDPPY
SSSAPGPGKPSGDVPLPQATYTTSPEIKRRHSQPQSPIIQGRVRMREVCKEIPLYIPHRF
QKEDSSSTHGPGDVGMKLANGHWKTKTIPWKTGNTRDGPDHVGVEPRSRPSLSLTSEKSQ
GNTTIGSKTEENELKSNEGRKQCLKKLALTQEQKSQLLDWNDANAENLSLDTGELMHAGN
ERGETSKLSNLSSFPGPAKEALSHQRETPQESCGPTPRATREVAVNRPKSPLRLIANAIR
KSLEPLLSNPEGGKKNSDSRPKTLMENLSLNGPQPCDQSPNLKKTSYSKDCDVQKPTLSS
LLVPGNERGTSDSAISLHVAPEAQPVTRGLSDRVARARSLPSRQKRSMTLPSAIVEDSST
LLDKVNLKEVLLGKSLDQYKALTKKGSLFSSFRLKEKTYESLGSMKTRKDLGSIFSNPGA
KDICYTPKKPSEPWNKSSSGQMDILLPGENLSSMHLPVRAQMTECYSSFSSSDTTSSSDG
EFEPQPSLPPKERRTLKRIKKMEKASKQLAKQEEFKRLYKAQAIQRQLEEVEERQRASEI
QGVELEKALRGESDSGAQDEARLLHEWFKLVLEKNKLMRYESELLIMAQELELEDHQSRL
EQKLREKMCMEESEKDDSIRNEEQEIFTKMMRVIEQRDRLVDSLEEQRVKEKAEDQHFEN
FMLSRAYQLSRS
Download sequence
Identical sequences F7CXM0
ENSMODP00000010644 ENSMODP00000010644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]