SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010652 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000010652
Domain Number - Region: 178-202
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0034
Family CCCH zinc finger 0.0032
Further Details:      
 
Domain Number - Region: 13-41
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0089
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010652   Gene: ENSMODG00000008566   Transcript: ENSMODT00000010860
Sequence length 373
Comment pep:known_by_projection chromosome:BROADO5:7:100933671:101055860:-1 gene:ENSMODG00000008566 transcript:ENSMODT00000010860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGR
CSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQMQFMFPGTPLHPVPTFPVGP
ALGTNAAISFAPYLTPVTPGVGLVPTEILPTTPVIVPGSPPVTVPGSAATQKLLRTDKLE
VCREFQRGNCARGETDCRFAHPSDSTMIDTNDNTVTVCMDYIKGRCMREKCKYFHPPAHL
QAKIKAAQHQANQAAVAAQAAAAAATVMTQSTAKAMKRPLEATVDLAFPPGALHPLPKRQ
ALEKSNGASAVFNPSVLHYQQALANAQLQQHTAFIPTVPMMHSATSATVSAATTPATSVP
FATTATANQIILK
Download sequence
Identical sequences F7CX91
ENSMODP00000010652 XP_001377222.3.35504 ENSMODP00000010652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]