SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010707 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010707
Domain Number 1 Region: 35-285
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.17e-94
Family CAF1-like ribonuclease 0.00000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010707   Gene: ENSMODG00000008609   Transcript: ENSMODT00000010919
Sequence length 315
Comment pep:known_by_projection chromosome:BROADO5:1:348881713:348992091:1 gene:ENSMODG00000008609 transcript:ENSMODT00000010919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKHCLVSFLHPVLAEGVFSGFFRMPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYI
AMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQF
NFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFH
SGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLD
LQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSA
QEKMSILAIINNMQQ
Download sequence
Identical sequences F6PHB4
ENSMODP00000010707 ENSMODP00000010707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]