SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010717 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010717
Domain Number 1 Region: 61-157
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.31e-20
Family Canonical RBD 0.0000034
Further Details:      
 
Domain Number 2 Region: 323-413
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.65e-16
Family Canonical RBD 0.0039
Further Details:      
 
Domain Number 3 Region: 160-265
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000521
Family Canonical RBD 0.00027
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010717
Domain Number - Region: 449-524
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00667
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010717   Gene: ENSMODG00000008617   Transcript: ENSMODT00000010929
Sequence length 541
Comment pep:known_by_projection chromosome:BROADO5:1:662345084:662398232:1 gene:ENSMODG00000008617 transcript:ENSMODT00000010929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSSSPGEPYEEREYESQAKRLKTEEGEIDYSAEEGESRREPASRGGGEGGGRSYSLPE
SGGSHHKVSVSPVVHVRGLCESVVEADLVEALEKFGTICYVMMMPFKRQALVEFENIDSA
KECVTFAADEPVYIAGQQAFFNYSTSKRITRPGNTDDPSGGNKVLLLSIQNPLYPITVDV
LYTVCNPVGKVQRIVIFKRNGIQAMVEYPSFNSFLCAQKAKAALNGADIYAGCCTLKIEY
ARPTRLNVIRNDNDSWDYTKPYLGRRDRGKGRQRQAILGEHPSSFRHDGYGSHGPLLPLP
SRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCSRVFNLFCLYGN
IEKVKFMKTIPGTALVEMGDEYAVERAVTHLNNVKLFGKRLNVCVSKQHSVVPSQIFELE
DGTSSYKDFAMSKNNRFTSAGQASKNIIQPPSCVLHYYNVPLCVTEDTFAKLCFDHEVLT
FIKYKVFDAKPSAKTLSGLLEWECKTDAVEALTALNHYQIRVPNGSNPYTLKLCFSTSSH
L
Download sequence
Identical sequences F6PH83
13616.ENSMODP00000010717 ENSMODP00000010717 ENSMODP00000010717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]