SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010721 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010721
Domain Number 1 Region: 25-189
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0000000000114
Family Rhomboid-like 0.0089
Further Details:      
 
Domain Number 2 Region: 300-361
Classification Level Classification E-value
Superfamily UBA-like 0.000000102
Family UBA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010721   Gene: ENSMODG00000008618   Transcript: ENSMODT00000010933
Sequence length 386
Comment pep:known_by_projection chromosome:BROADO5:3:517813425:517827382:-1 gene:ENSMODG00000008618 transcript:ENSMODT00000010933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGRERQAPMMQMIRGLPLASSLLLLLLCCLWVLGAGPNLALDPDLLLGHWQVHRLLTF
PLGHTALPALLLSLLLFPTLGWYQESHLGTLRYVHASALSTVATGLLYLLLAGLGVPGAR
SAGCGFSPIHLALLAAQHRSRTRLPGGVVPPLLLLALMHLVSSEPPFLLQLCGLLSGLAY
SAGLFRRLELSERRLQTLQKARMCRALEGSCLLCFIPAPGSPLELPIVLTASRSPRHSDS
GALGNLMPGLWASSPAPALLAPGLGPFPFEASVFEGVPPAETLLWSHGDSVDDNLLQAAI
RASLQDEPAPGAPEELRLPKSSVSSLRLQQLERMGFSTEQAVVALAATGRVEGAVSLLVE
GQVGDAAQVTSAGREEPAVHSGPGQS
Download sequence
Identical sequences F6PH35
ENSMODP00000029519 ENSMODP00000010721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]