SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010785 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010785
Domain Number 1 Region: 9-99
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.18e-24
Family Canonical RBD 0.0021
Further Details:      
 
Domain Number 2 Region: 90-126
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000209
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010785   Gene: ENSMODG00000008669   Transcript: ENSMODT00000010998
Sequence length 236
Comment pep:novel chromosome:BROADO5:1:662152882:662158959:1 gene:ENSMODG00000008669 transcript:ENSMODT00000010998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDA
EDAVRGLDGKVICGSRVRVELSTGMPRRSRYDRPPARRPFDPNDRCYECGEKGHYAYDCH
RYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSASLRRSRSASIRSRS
GSLKRSRYFQSSRSRSRSRSLSRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
Download sequence
Identical sequences F6PFZ6
XP_007477078.1.35504 XP_020832619.1.61212 ENSMODP00000010785 13616.ENSMODP00000010785 ENSMODP00000010785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]