SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010787 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010787
Domain Number 1 Region: 9-97
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.01e-23
Family Canonical RBD 0.002
Further Details:      
 
Domain Number 2 Region: 98-126
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000262
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010787   Gene: ENSMODG00000023693   Transcript: ENSMODT00000011000
Sequence length 235
Comment pep:novel chromosome:BROADO5:2:258485676:258486383:-1 gene:ENSMODG00000023693 transcript:ENSMODT00000011000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCYGRYGGETKVYVGNLETGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDA
EDAVQGLDGKVICGSRVRVELSTGLPRRSRYDRPPARCPFDPNDRCYECGEKGHYAYDCH
RYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRPRSASLRRSRSASIQSRS
GSLKRSRSSRSRSRSRSRSLSRPRSSQSKSRSPSPKRSHSPSGSPRRSASPERMD
Download sequence
Identical sequences F6PFZ3
ENSMODP00000010787 ENSMODP00000010787 13616.ENSMODP00000010787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]