SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010946 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010946
Domain Number 1 Region: 339-428
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.85e-20
Family Canonical RBD 0.0023
Further Details:      
 
Domain Number 2 Region: 23-61
Classification Level Classification E-value
Superfamily SAP domain 0.00000000916
Family SAP domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010946   Gene: ENSMODG00000008794   Transcript: ENSMODT00000011162
Sequence length 993
Comment pep:novel chromosome:BROADO5:1:161829011:161870688:1 gene:ENSMODG00000008794 transcript:ENSMODT00000011162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATASGSSAAASATSGQSESKKISDLRVIDLKSELKRRNLDINGVKNVLVSRLKQAIEE
EGGDPDNIDLSSSGDTSNKKAPAKSKGKKQETDELSGDASVEDDTFVKESESENQETSDP
DGNDELKDSEEFAENDEENNNSKDLSTVEQHKKDHELKQAEAGQGKEKDLENQENEGQEG
EDDTFLTVPDGEEEEKEKDIAGSGDGTQEVSKPLPSEENLAEADQTAHEEMEDSEASKPK
DGQDAIAQSLEKESKDYEMNESHKDGKKEDGVKGDAVEKEARESSKKAESGDKEKDTLKK
GPSSTGASGQAKSSSKESKESKTSSKDDKGSTSSTSGSSGSSTRNLWVSGLSSNTKAADL
KNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSSTEVARCIAHLHRTELHGQQISVEKV
KGDPSKKELKKESDEKSSSGRSTGDKKSASSDKTSKTQASTKKEEKKSEKSEKKESKDTK
KAEGKDEKGDNGSSGPTSESIKKSEEKKRISAKSPGHMVILDQTKGDHSRSSRRGRYDKV
ARNRERASQDKKKDKDYRSRKDILPFEKMKEQRMREHLVRLERIRRAVELRRRREIAERE
RRERERIRMIREREERERLQRERERLEIERQKLERERMERERLERERIRIEQERRKEAER
IAREREELRRQQQQLRYEQEKRNSLKRPRDVDHRRDDPYWNETKKLSLDTDARFSHGSDY
NRQQNRFNDFDHRERARFPEGTAVQSSSFERRERFVSQGEGKKTRPTARREDPGFERYPK
NFSDSRRNEPPPPRNELRDTDRREVRGDRDERRTVIIHDRPDIAHGRHPREGGPNPPRQT
SWKNEGGMSTEKRDTRGERPERSGREVSGHNVRGAPPGNRSSASGYGSREGERGVLGERG
SGGQHYSEDRHVVERHGRETSGPRKEWHGPSSQGSGYHDTRRMGDGRGGAGMIPQHTSNS
SPINRIVQITGNSMQRGSGSGFKPFKGGPPRRF
Download sequence
Identical sequences F6QVI9
ENSMODP00000010946 ENSMODP00000010946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]