SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010955 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010955
Domain Number 1 Region: 536-1012
Classification Level Classification E-value
Superfamily Ras GEF 6.67e-142
Family Ras GEF 0.0000000000000162
Further Details:      
 
Domain Number 2 Region: 2-148
Classification Level Classification E-value
Superfamily Histone-fold 2.12e-49
Family TBP-associated factors, TAFs 0.000000569
Further Details:      
 
Domain Number 3 Region: 181-370
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-39
Family DBL homology domain (DH-domain) 0.0000000158
Further Details:      
 
Domain Number 4 Region: 388-541
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-38
Family Pleckstrin-homology domain (PH domain) 0.000000936
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010955   Gene: ENSMODG00000008801   Transcript: ENSMODT00000011171
Sequence length 1301
Comment pep:known_by_projection chromosome:BROADO5:1:661794505:661874344:1 gene:ENSMODG00000008801 transcript:ENSMODT00000011171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQMQVHPTLASNEDALQYVEELILQLLSMLCQAQPRSVLDVEDRVQKSFPHPIDKWAIAD
AQSANEKRKRRNPLSLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADILKLVGNYV
RNIRHYEITKQDIKVAMCADKVLMDMFHQDVEDINILSLTDEEPSTSGETCYDLVKAFMP
EVRQYIRELNLLTKVFSDPLYSGGGVSSLQDVENIFSRIADIHELSVKLLGHIEDTVEMT
DEGSPHPLVGSCFEDLAEELAFDPYESYAQDILRPGFHDHFLSQLSKPGAALYLQSIGEG
FKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNLQSSMERI
CSKSLAKRRLSESACRFYSQQMKGKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTL
TRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRKVQINDKDDTNEY
KHAFEIILKDESVIFSAKSAEEKNNWMAALISLQYRSTLERMLDVTMLQEEKEEQMRLPS
SDLYRFAEPDSEENIVFEENMQPKSGIPIIKAGTVIKLIERLTYHMYADPNFVRTFLTTY
RSFCKPQELLSLLIERFEIPEPEPTEADRIAMENGDQPLSVELKRFRKEYIQPVQLRVLN
VCRHWVEHHFYDFERDTDLLQRLEEFIGTVRGKAMKKWVESITKIIQRKKMARDNGPGHN
ITFESSPPAVEWHISRPGHTETFDLLTLHPIEIARQLTLLESDLYRAVQPSELVGSVWTK
EDKEINSPNLLKMIRHTTNLTLWFEKCIVEAENLEERVAVVSRIIEILQVFQELNNFNGV
LEVVSAMNSSPVYRLDHTFEQIPSRQKKILEEAHELSEDHYKKYLAKLRSINPPCVPFFG
IYLTNILKTEEGNPEVLKRHGKELINFSKRRKVAEITGEIQQYQNQPYCLRVESDIKRFF
ENLNPMGNSMEKEFTDYLFNKSLEIEPRNPKPLPRFPKKYNYPLKSPGVRPSNPRPGTMR
HPTPLQQEPRKISYSRIPESETESTASAPNSPRTPLTPPPASGASSTTDVCSVFDSDHSS
PFHSSSDTIFIQVTLPHGPRSASVSSISLTKSTDEMTIPPPVPPRRRPESAPAESSPSKI
MSKHLDSPPAIPPRQPTSKVYSPRYSDRTSISDPPESPPLLPPREPVRTPDVFSSSPLHL
QPPPLGKKSEHGNTFFPNSPSPFTPPPPQTPSPHGTRRHLPSPPLTQQDVDLHSIPGPPV
PPRQSTSQHIPKLPPKTYKREHTHPSMHRDGPPLLENAHSS
Download sequence
Identical sequences F6QUW1
ENSMODP00000010955 13616.ENSMODP00000010955 ENSMODP00000010955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]