SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011084 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011084
Domain Number 1 Region: 29-91
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000524
Family Canonical RBD 0.011
Further Details:      
 
Domain Number 2 Region: 87-115
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000075
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000011084
Domain Number - Region: 128-178
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0379
Family PspA lactotransferrin-binding region 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011084   Gene: ENSMODG00000008893   Transcript: ENSMODT00000011301
Sequence length 209
Comment pep:novel chromosome:BROADO5:8:63088438:63117800:1 gene:ENSMODG00000008893 transcript:ENSMODT00000011301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMHPKERKIQKALAIFNNGPHLYLTIHWKRVTIMKDKDTRKSKGVAFILFLDKESAQNCS
RALNNKQLFGRVIKASIAIDNGRAAEFIRRRNYFDKSRCYECGETGHLSYACPKNVLGER
EPPKKKEKKKRKKIIELEEEIEEVEESEDEGEDPALDSLSQAIAFQQAKIEEDQQRWKPS
ASEPSTSDDSRRPRIKKSAYFSDEEELSD
Download sequence
Identical sequences F7BRG5
XP_007503210.1.35504 ENSMODP00000011084 ENSMODP00000011084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]