SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011106 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011106
Domain Number 1 Region: 866-975
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000048
Family Canonical RBD 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011106   Gene: ENSMODG00000008910   Transcript: ENSMODT00000011323
Sequence length 1112
Comment pep:known_by_projection chromosome:BROADO5:2:522653037:522682292:-1 gene:ENSMODG00000008910 transcript:ENSMODT00000011323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVRSGPRGRGRRPTLSSGRDPGRRRRRLREAVTATAVASTEVAERLPWTRAPMHDEPSS
PKRKHFFLASHYYDESGSGESLLTISHDRCNFLVLKPMEQDDVSFLDKSESSDSSSLGSQ
PAAQDRAPRPPSELSDIVDYALLNDTYSIHVADADTKLKDHFTYLSSEADLELQEGGPFF
EILKTSSEDSLGLEEICKNLDGDYEEMLGGEMAPHVLDEDSQQEYHSAEEHDYPGFHLDF
DPIKTLCDPNSEVIELGNSDFEIKCVSGLGENHVKKLESGPFFCEPSHLRTQGRLPEVSK
FHDYLSLPESHGQKPRRGHEPEAGFRNPCLFDGLTQTGGSAEDADVTCGQPALPGSSSEK
AVCPDPRKCQTTEDKDICAEEEGGSVLKSGEKPFLERISAASRQPSACLQNSTPCIFDES
SVSAYDRSCYKFIHGATEPALDFLRTVPKALAKDSHLGEEDGPAKVAAADLMNKTHLISV
ESKYAKRSLDAACDCLVTVNQTIDASSDFRACFTTSRATSARSLVASRSSNTEITMMNKA
RPHEWLNEKQRSVACNTDWSCLASWAEEDFRLHGALPKGLEKTIPAESLKANDSVSVKDY
LELKNKYDVKDSKKNPEGHFQPCKEVEKNVLSKCCQKTLQRAIRAELLLLKAHYQMCHQH
CWKLYRLVMEEKESFTRHFASDFAKTELGSTLLSLFGDLKFKYLSMREKIIKGVPLDELP
PLAVESRLLSFFSTFVPSKLMKEDSHIFLGPRSDLSVPGAPNTNSSAVEPPRALSQSTRA
SEHRTRPKREVALPGDSRKTRDLNVGIRNLRLDDEDYRKCQDPSEAWFDAKENLTGTERL
EMPGDEAEPTKRSSKPSPEKVAAEPSRKEPDRSYLIHVGSLCPSVSETDLMSHFQKYQVS
EVSICTSHNYRYASLVFKKANRARLAVEEMNGKEINGKSVNVRLVKTPAENVPPLSWRGE
SRPALRGPEPATDGRGCGSASVPPSKFPAHVPRLPEPENAYFSVDHRGGRKGSKPNKSVK
WVPESPLPYVPPNTLNLGSFTKLLRKLEGLHPNVSRDTIIDALQEVRTNNKGFLSGLSLT
AIVDMTTSVLRTAALQKEERKRQQEAPKAGIH
Download sequence
Identical sequences F7GL94
ENSMODP00000011106 XP_007485961.1.35504 ENSMODP00000011106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]